(data stored in ACNUC10821 zone)

EMBL: AE017262.PE549

AE017262.PE549       Location/Qualifiers
FT   CDS             570844..572340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03339"
FT                   /protein_id="AAT03339.1"
FT                   /translation="MRKKLIVSILLAFMIFVVGGHSAIAKSDDGVVVFYDSLATGTENE
FT                   GNMDALLRMLNSLGKRVTIYSWEENPDLSQTSEIIVLQNKKDGLSNKWTNKLAKSKAKI
FT                   AYIGGNPPTFLTDKLQLKTKVITDASITIQTAAGLSGKPQLVNETNLITSYKGTSFGEM
FT                   DAAENGQAAYGVQAGNYAYAPLFQADNTSEFALMDVLKALFDIKTTTNQYAFITGVNPF
FT                   IDFDLLKKTADTFYEKGIPFIVSAGPVFYNQDFQAAKNYAEILRYVQAKNGTIMMNVPA
FT                   VTHGDSPSGELESIMQKSVHFFAENDVAPLGVTAELYWNFDKVYGVEGFAPFNTGILLP
FT                   NQKIIHTTKVNNGSAFEKSPYSVANDFYATTTEGRNFPIDIAITYPFFTNEKELKAAAE
FT                   ELATDNISDFRFQDHGVKTNKDTIESSAGSLYINNQSVTLDGDLNYIKTKNKTVKQAGS
FT                   LEGFFGYQNTFFTIVIVLSLGIIGVLFVFGYRLYMKKYMK"
     MRKKLIVSIL LAFMIFVVGG HSAIAKSDDG VVVFYDSLAT GTENEGNMDA LLRMLNSLGK        60
     RVTIYSWEEN PDLSQTSEII VLQNKKDGLS NKWTNKLAKS KAKIAYIGGN PPTFLTDKLQ       120
     LKTKVITDAS ITIQTAAGLS GKPQLVNETN LITSYKGTSF GEMDAAENGQ AAYGVQAGNY       180
     AYAPLFQADN TSEFALMDVL KALFDIKTTT NQYAFITGVN PFIDFDLLKK TADTFYEKGI       240
     PFIVSAGPVF YNQDFQAAKN YAEILRYVQA KNGTIMMNVP AVTHGDSPSG ELESIMQKSV       300
     HFFAENDVAP LGVTAELYWN FDKVYGVEGF APFNTGILLP NQKIIHTTKV NNGSAFEKSP       360
     YSVANDFYAT TTEGRNFPID IAITYPFFTN EKELKAAAEE LATDNISDFR FQDHGVKTNK       420
     DTIESSAGSL YINNQSVTLD GDLNYIKTKN KTVKQAGSLE GFFGYQNTFF TIVIVLSLGI       480
     IGVLFVFGYR LYMKKYMK                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page