(data stored in ACNUC10821 zone)

EMBL: AE017262.PE550

AE017262.PE550       Location/Qualifiers
FT   CDS             572351..573601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0558"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03340"
FT                   /protein_id="AAT03340.1"
FT                   /translation="MVIADYLALFAVVCIWGLLLINIVLIVAGYVYYLKNEARKVPEIP
FT                   AEVPFVSVMVPAHNEGKVIVKTVESLLAFDYPVDRYEIIVINDNSSDNSAELLAAIQAK
FT                   NPTRFLKIINTDNITGGKGKSNALNIGFAESRGELVAIYDADNTPERQALRILVGEITN
FT                   DAKLGAVIGKFRTRNRNASWLTRFINIETLSFQWMAQAGRWALFKLCTIPGTNFIVRRS
FT                   LLEEIGGWDVKAVAEDTEISFRIYMMGYRIKFQAKAVTWEQEPQTLPVWFKQRSRWAKG
FT                   NIYVILKNVPLLFKREGRRVRFDILYFLSIYFLLLTSLIVSDVLLVLYALGLVHTTLAG
FT                   LSGALWLLAILLFVAGTFITLTTEKGEISFSNLLFIMLMYVTYCQLWMVVAAYGFFIFL
FT                   KDTILKRETKWYKTERF"
     MVIADYLALF AVVCIWGLLL INIVLIVAGY VYYLKNEARK VPEIPAEVPF VSVMVPAHNE        60
     GKVIVKTVES LLAFDYPVDR YEIIVINDNS SDNSAELLAA IQAKNPTRFL KIINTDNITG       120
     GKGKSNALNI GFAESRGELV AIYDADNTPE RQALRILVGE ITNDAKLGAV IGKFRTRNRN       180
     ASWLTRFINI ETLSFQWMAQ AGRWALFKLC TIPGTNFIVR RSLLEEIGGW DVKAVAEDTE       240
     ISFRIYMMGY RIKFQAKAVT WEQEPQTLPV WFKQRSRWAK GNIYVILKNV PLLFKREGRR       300
     VRFDILYFLS IYFLLLTSLI VSDVLLVLYA LGLVHTTLAG LSGALWLLAI LLFVAGTFIT       360
     LTTEKGEISF SNLLFIMLMY VTYCQLWMVV AAYGFFIFLK DTILKRETKW YKTERF           416
//

If you have problems or comments...

PBIL Back to PBIL home page