(data stored in ACNUC10821 zone)

EMBL: AE017262.PE551

AE017262.PE551       Location/Qualifiers
FT   CDS             573617..575668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0530"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03341"
FT                   /protein_id="AAT03341.1"
FT                   /translation="MKKLTVIGLLMFAVLFLYRPDVLAADKNYQTVFGTDKTAQGKFTT
FT                   TKQNFTVENYWDVSNANVKLVYTITQLSEKEVSTMTLKINDVAFYSFKPDKADKGTKQI
FT                   EIEIPKDKLKKGVNVLSIESFVYTDLPDGRCTIDDTPANWLQFDKTSAVNVSYSDKAFQ
FT                   KTIAEFGERFTGIDTVKSEQGAVAVSNKAGDAELGAALEGLSGFSAVNTLEDKNIAFGQ
FT                   YEEAKTRDGKNYLVLFSSYDNLPNDLKSQIKDDNKLEKQALFQVVTVGNTNTLVVTSKS
FT                   NDALKKAGKLIANQNYLSQLGTNTKWLTTDEKIDTPATNVDKNTKLTTTGDKLKGIGHI
FT                   TQDYFISMPANRSASTGTEVSLDFRYAQNLDFEHSLVTILVNGKPIGSQKLTAKKANGD
FT                   KLTFQIPSDLNVKGDFSVTVAFDLVLTNNYCGFIADSEIPWAYITPESKINLNTSEETD
FT                   LLFEQYPYPFIANGDFNNAVVVVPDKLTTEDTDSLANIFNLLGRFHDGNRGDLTAVHAA
FT                   NWKKPKEGSNIIAVGTMNNNPVIKNANDDLYFQYNKTGDYFLSNEKISIEKNYGKQLGS
FT                   VQLITSDGVPILAVTGPGAKQTELGSDLIATKANLAKIYGDGAIVDTDNTIHSYRFKKA
FT                   ADTQEESFGSKISNNKEVTVFGAFALLTVVILVVAVLLILRKYRRSRK"
     MKKLTVIGLL MFAVLFLYRP DVLAADKNYQ TVFGTDKTAQ GKFTTTKQNF TVENYWDVSN        60
     ANVKLVYTIT QLSEKEVSTM TLKINDVAFY SFKPDKADKG TKQIEIEIPK DKLKKGVNVL       120
     SIESFVYTDL PDGRCTIDDT PANWLQFDKT SAVNVSYSDK AFQKTIAEFG ERFTGIDTVK       180
     SEQGAVAVSN KAGDAELGAA LEGLSGFSAV NTLEDKNIAF GQYEEAKTRD GKNYLVLFSS       240
     YDNLPNDLKS QIKDDNKLEK QALFQVVTVG NTNTLVVTSK SNDALKKAGK LIANQNYLSQ       300
     LGTNTKWLTT DEKIDTPATN VDKNTKLTTT GDKLKGIGHI TQDYFISMPA NRSASTGTEV       360
     SLDFRYAQNL DFEHSLVTIL VNGKPIGSQK LTAKKANGDK LTFQIPSDLN VKGDFSVTVA       420
     FDLVLTNNYC GFIADSEIPW AYITPESKIN LNTSEETDLL FEQYPYPFIA NGDFNNAVVV       480
     VPDKLTTEDT DSLANIFNLL GRFHDGNRGD LTAVHAANWK KPKEGSNIIA VGTMNNNPVI       540
     KNANDDLYFQ YNKTGDYFLS NEKISIEKNY GKQLGSVQLI TSDGVPILAV TGPGAKQTEL       600
     GSDLIATKAN LAKIYGDGAI VDTDNTIHSY RFKKAADTQE ESFGSKISNN KEVTVFGAFA       660
     LLTVVILVVA VLLILRKYRR SRK                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page