(data stored in ACNUC10821 zone)

EMBL: AE017262.PE552

AE017262.PE552       Location/Qualifiers
FT   CDS             575683..576537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0531"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03342"
FT                   /protein_id="AAT03342.1"
FT                   /translation="MKKITNNLFADIGFLFFILLCFITIGFMINTPDEYLRNIILLNIT
FT                   FLLVIITYFTNLTLGLILNVLYIFIYATYIIYEIVANQIAYGFGSYFWLIITPLFTVAS
FT                   AMFTRNTSRLQEENTKIKQQNLYLGTIDQETLLKNIVSFQNDERIFSSISRRYDLPLSL
FT                   MVIKVRHWRELKRFQSEEEMRLALQDISAILETCIRTSDVLYLLDKDDATWGLLLLTDE
FT                   PGGKLVADRIKSRIAEANTEEFAAKYRVKLELRIGTSQFDSEKVKTPLDFIDLATKELE
FT                   YDV"
     MKKITNNLFA DIGFLFFILL CFITIGFMIN TPDEYLRNII LLNITFLLVI ITYFTNLTLG        60
     LILNVLYIFI YATYIIYEIV ANQIAYGFGS YFWLIITPLF TVASAMFTRN TSRLQEENTK       120
     IKQQNLYLGT IDQETLLKNI VSFQNDERIF SSISRRYDLP LSLMVIKVRH WRELKRFQSE       180
     EEMRLALQDI SAILETCIRT SDVLYLLDKD DATWGLLLLT DEPGGKLVAD RIKSRIAEAN       240
     TEEFAAKYRV KLELRIGTSQ FDSEKVKTPL DFIDLATKEL EYDV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page