(data stored in ACNUC10821 zone)

EMBL: AE017262.PE558

AE017262.PE558       Location/Qualifiers
FT   CDS             581754..583025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0566"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="identified by similarity to SP:Q01264; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01879"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03348"
FT                   /protein_id="AAT03348.1"
FT                   /translation="MQTNLERIKKHIEKLDTYTATPGQGTTRLTYSKEDLDARNYLKQE
FT                   MAKVGLAVSEDAIGNIYGRLEGENPNLPAVIVGSHFDSVPNGGAFDGPAGVITGLEVAT
FT                   VFYEQQIKPHFPLEIIAMVEEEGARFGAGLLASRTITGKVTKEMLHEMKDIDGITAAEA
FT                   MAKVGFDANQVVTAIRTKESVKAFIELHIEQGPVLENANEDVALVDTVVGLTEIKVTVK
FT                   GQAGHAGTTPMLDRKDALITAVEILGQLPELAIQEGGGTVLTVGKLNVYPNGANVIPDK
FT                   VVFTVDIRAKDEIHVQNTLAKTKEIIQSAEKNGITCEIEDMLYEPPTHLSKEIHQALTE
FT                   SADQLGLKYRTMVSGAGHDAMIFAGLTEVGLIFVPSHNGISHAPEEWTDYDKLQKGIEV
FT                   VLETVKKWTEESANESENKTSSFK"
     MQTNLERIKK HIEKLDTYTA TPGQGTTRLT YSKEDLDARN YLKQEMAKVG LAVSEDAIGN        60
     IYGRLEGENP NLPAVIVGSH FDSVPNGGAF DGPAGVITGL EVATVFYEQQ IKPHFPLEII       120
     AMVEEEGARF GAGLLASRTI TGKVTKEMLH EMKDIDGITA AEAMAKVGFD ANQVVTAIRT       180
     KESVKAFIEL HIEQGPVLEN ANEDVALVDT VVGLTEIKVT VKGQAGHAGT TPMLDRKDAL       240
     ITAVEILGQL PELAIQEGGG TVLTVGKLNV YPNGANVIPD KVVFTVDIRA KDEIHVQNTL       300
     AKTKEIIQSA EKNGITCEIE DMLYEPPTHL SKEIHQALTE SADQLGLKYR TMVSGAGHDA       360
     MIFAGLTEVG LIFVPSHNGI SHAPEEWTDY DKLQKGIEVV LETVKKWTEE SANESENKTS       420
     SFK                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page