(data stored in ACNUC10821 zone)

EMBL: AE017262.PE56

AE017262.PE56        Location/Qualifiers
FT   CDS             58564..58716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0058"
FT                   /product="putative accessory gene regulator protein D"
FT                   /note="identified by similarity to OMNI:NTL01LI0042"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02846"
FT                   /protein_id="AAT02846.1"
FT                   /translation="MNKSVGKFLSRKLEEQSMKVADSSMSKACFMFVYEPKSPFVKMQE
FT                   KNENK"
     MNKSVGKFLS RKLEEQSMKV ADSSMSKACF MFVYEPKSPF VKMQEKNENK                   50
//

If you have problems or comments...

PBIL Back to PBIL home page