(data stored in ACNUC10821 zone)

EMBL: AE017262.PE560

AE017262.PE560       Location/Qualifiers
FT   CDS             complement(584214..585230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0568"
FT                   /product="putative tagatose 1,6-diphosphate aldolase"
FT                   /note="identified by match to protein family HMM PF04274"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03350"
FT                   /db_xref="GOA:Q723B1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723B1"
FT                   /protein_id="AAT03350.1"
FT                   /translation="MVQITKGKFDGLQRLSNEKGVIAALAIDQRGSLKKMIQQAKGTEN
FT                   KKDVEDFKQLVSEELTPYASAILLDLEYGTPAIKARHEGSGLLTSYEKTGYDATTPGKL
FT                   PDLIEDLSALRIKENGGDAVKILVYYDPDEPAEINEIKYAFLERIGAECRAVDIPFFLE
FT                   PITYDATVTDSGSLEYAKLKPAKVKASIKEFSKPRYGVDVLKLEVPVNFKYVEGFAEGE
FT                   VAYTQDEAARHFEECSDLSPLPFIYLSAGVTSEMFHKTIQFANQHNVQYSGVLCGRATW
FT                   ADGIEVYGKQGDDALREWLRTQGKENITSLDKLLDEGAVPWWTKYGSFEDVHVVEKQ"
     MVQITKGKFD GLQRLSNEKG VIAALAIDQR GSLKKMIQQA KGTENKKDVE DFKQLVSEEL        60
     TPYASAILLD LEYGTPAIKA RHEGSGLLTS YEKTGYDATT PGKLPDLIED LSALRIKENG       120
     GDAVKILVYY DPDEPAEINE IKYAFLERIG AECRAVDIPF FLEPITYDAT VTDSGSLEYA       180
     KLKPAKVKAS IKEFSKPRYG VDVLKLEVPV NFKYVEGFAE GEVAYTQDEA ARHFEECSDL       240
     SPLPFIYLSA GVTSEMFHKT IQFANQHNVQ YSGVLCGRAT WADGIEVYGK QGDDALREWL       300
     RTQGKENITS LDKLLDEGAV PWWTKYGSFE DVHVVEKQ                               338
//

If you have problems or comments...

PBIL Back to PBIL home page