(data stored in ACNUC10821 zone)

EMBL: AE017262.PE562

AE017262.PE562       Location/Qualifiers
FT   CDS             complement(586701..587621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0570"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03352"
FT                   /protein_id="AAT03352.1"
FT                   /translation="MYQKHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVTDT
FT                   MDRKVEVPTTPKRIVALQNVSEMEILGVKPVGTTDYYITTYPEATKGTESVGNDKPSIE
FT                   KIANLKPDLIIISDYQKDLLENLEKVAPVYITHFGDTPDKQLSNIANLLNKKAEKEKWD
FT                   KDYAASSKEAKATLKDAGVANEKAAVIQFYGKEIYVHDAKVFDGLYSGAGFTPTDAAKA
FT                   NKETKAISSEAIPEYAAGADRLFILMPADGNTDSVDEMLKGVWKDIPAVKKNQVYKVDN
FT                   TKWSDYSASAQLYQMEDAVKQITGK"
     MYQKHKWAAI LMTVLLAVVL TACGSSSDKD SSKEKESATK TVTDTMDRKV EVPTTPKRIV        60
     ALQNVSEMEI LGVKPVGTTD YYITTYPEAT KGTESVGNDK PSIEKIANLK PDLIIISDYQ       120
     KDLLENLEKV APVYITHFGD TPDKQLSNIA NLLNKKAEKE KWDKDYAASS KEAKATLKDA       180
     GVANEKAAVI QFYGKEIYVH DAKVFDGLYS GAGFTPTDAA KANKETKAIS SEAIPEYAAG       240
     ADRLFILMPA DGNTDSVDEM LKGVWKDIPA VKKNQVYKVD NTKWSDYSAS AQLYQMEDAV       300
     KQITGK                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page