(data stored in ACNUC10821 zone)

EMBL: AE017262.PE566

AE017262.PE566       Location/Qualifiers
FT   CDS             complement(589654..590034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0545"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03356"
FT                   /protein_id="AAT03356.1"
FT                   /translation="MNIVLIASLIFIAQTGLAFFQVRYYQHHMNKVADKYAEKTGYYLY
FT                   SEMERLKFRTSAVAILVVNENRVVHECQILTGKTVFAKFKTFTNYHHKDLSEILTDLSS
FT                   KNKNTIQEKAIIKTVNSCMKAL"
     MNIVLIASLI FIAQTGLAFF QVRYYQHHMN KVADKYAEKT GYYLYSEMER LKFRTSAVAI        60
     LVVNENRVVH ECQILTGKTV FAKFKTFTNY HHKDLSEILT DLSSKNKNTI QEKAIIKTVN       120
     SCMKAL                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page