(data stored in ACNUC10821 zone)

EMBL: AE017262.PE569

AE017262.PE569       Location/Qualifiers
FT   CDS             592912..593577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412992"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03359"
FT                   /protein_id="AAT03359.1"
FT                   /translation="MEKLFTYKEFVDMMQKYGIRHTKRKLRRGENLMENASKFSNVVLL
FT                   IDGYISSYTYESPEKLLSIFEPGIFLRYSILEDQPEFVTNIALSDNCEVYEYKKEDIEY
FT                   ALTLFPENFGFQYFFLKRIGRHLYYRALLNGKEHKDKLYYAMKYLGELIGKTDENGNVS
FT                   LPPEVTLKVLIEYSTLSKAAFYRQRIHLLEQEILKPHENTFIVQKKVASHYEDQLTSI"
     MEKLFTYKEF VDMMQKYGIR HTKRKLRRGE NLMENASKFS NVVLLIDGYI SSYTYESPEK        60
     LLSIFEPGIF LRYSILEDQP EFVTNIALSD NCEVYEYKKE DIEYALTLFP ENFGFQYFFL       120
     KRIGRHLYYR ALLNGKEHKD KLYYAMKYLG ELIGKTDENG NVSLPPEVTL KVLIEYSTLS       180
     KAAFYRQRIH LLEQEILKPH ENTFIVQKKV ASHYEDQLTS I                           221
//

If you have problems or comments...

PBIL Back to PBIL home page