(data stored in ACNUC10821 zone)

EMBL: AE017262.PE570

AE017262.PE570       Location/Qualifiers
FT   CDS             593595..595628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0578"
FT                   /product="leucine rich repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00560"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03360"
FT                   /protein_id="AAT03360.1"
FT                   /translation="MKFNWKVVLLFVLILALIVPVYSKAVETGKELPKSPELQDDKSST
FT                   LKNVNTPKNLKASPLTIPANSTIADLFPDEGMAKTVANQLGRTENNNFQTPTKTDWKVD
FT                   DVVTEVELNRMWYLTSVATIGSIEGIQYLPNLYNVQLQFDDQCKDLSPFLKAPNGYPQL
FT                   YRLNINNGNISDISPLTELSAPTLKYIDLAGNNISDLSLFKKLPNKLPSLEEISVERNN
FT                   ISDVSPLADFASTKIKVFDLDDNHITDLSSLTNNKMPNLQRLYVRSQSFYVETPVVTSS
FT                   KYEFSLQPSVFGITKPVKITATNPKATIDPITSKITYSAEVMAKRPKYSSNRVSGVSGV
FT                   TYSWDEDIPFNGSNNLVEYNGTFYKPLTYVEPPQVVSYNSGLTYELGTPLTEQQFLNDL
FT                   NVITDQPTTITTNFDKVLKDVNSVGFYPVTIKASNIEGNTEFTTSVLIKYKPPVITADA
FT                   EYTYLVGDKVNATQFRADVNATLTGEGTLRDDFIYKVRLNTAGDYVVTLSSPKSGYYKQ
FT                   DAIPVTVIVHVKELLELQIPDEFRMDIDANADSVPISDKKQTLTCYGSSGKAELEVIDR
FT                   RTVRQGWTITGAMTPFTNSGGDILQTSLKYQSKSPSSSPIYLNTTNQPIEKKQSAVTDP
FT                   KYDSTIVNLEDSLSMEIEPNDALVNDSYESKITWTLEDAPRP"
     MKFNWKVVLL FVLILALIVP VYSKAVETGK ELPKSPELQD DKSSTLKNVN TPKNLKASPL        60
     TIPANSTIAD LFPDEGMAKT VANQLGRTEN NNFQTPTKTD WKVDDVVTEV ELNRMWYLTS       120
     VATIGSIEGI QYLPNLYNVQ LQFDDQCKDL SPFLKAPNGY PQLYRLNINN GNISDISPLT       180
     ELSAPTLKYI DLAGNNISDL SLFKKLPNKL PSLEEISVER NNISDVSPLA DFASTKIKVF       240
     DLDDNHITDL SSLTNNKMPN LQRLYVRSQS FYVETPVVTS SKYEFSLQPS VFGITKPVKI       300
     TATNPKATID PITSKITYSA EVMAKRPKYS SNRVSGVSGV TYSWDEDIPF NGSNNLVEYN       360
     GTFYKPLTYV EPPQVVSYNS GLTYELGTPL TEQQFLNDLN VITDQPTTIT TNFDKVLKDV       420
     NSVGFYPVTI KASNIEGNTE FTTSVLIKYK PPVITADAEY TYLVGDKVNA TQFRADVNAT       480
     LTGEGTLRDD FIYKVRLNTA GDYVVTLSSP KSGYYKQDAI PVTVIVHVKE LLELQIPDEF       540
     RMDIDANADS VPISDKKQTL TCYGSSGKAE LEVIDRRTVR QGWTITGAMT PFTNSGGDIL       600
     QTSLKYQSKS PSSSPIYLNT TNQPIEKKQS AVTDPKYDST IVNLEDSLSM EIEPNDALVN       660
     DSYESKITWT LEDAPRP                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page