(data stored in ACNUC10821 zone)

EMBL: AE017262.PE571

AE017262.PE571       Location/Qualifiers
FT   CDS             595668..595964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03361"
FT                   /protein_id="AAT03361.1"
FT                   /translation="MKKMGFILICCLFVCASPFYVKANTDKATSKAGVIFTHDPRKPRT
FT                   GTDDRSGTFPTKVPPKRLPKTGDTTDFYLVLLGFGFILIAKKGYFKEVREEIR"
     MKKMGFILIC CLFVCASPFY VKANTDKATS KAGVIFTHDP RKPRTGTDDR SGTFPTKVPP        60
     KRLPKTGDTT DFYLVLLGFG FILIAKKGYF KEVREEIR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page