(data stored in ACNUC10821 zone)

EMBL: AE017262.PE572

AE017262.PE572       Location/Qualifiers
FT   CDS             596008..596850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03362"
FT                   /protein_id="AAT03362.1"
FT                   /translation="MTSRTVKVTTASLLALGLIVAPVLSGDFASAATFVTKDSKGIVKF
FT                   DKSTTPDPDPVNPDPVDPDPVIPDPTDPPVGTDGLWILAVSDWDFGTHNVSSLSSGALN
FT                   VHAADDTISTYVDANGNGQQDLPGEVSVTKKVTPYAQISDVRGTNTGWTLSVTGSAFKD
FT                   SSTPAKTIPGAELTIPKSTVSSATSTAQAPTGYDSVTISMTGGAAVPVMAAKDMQTATP
FT                   TNFNDDQGMGTWTDSFGSQAVSATDTSKPKLSIPKNVVVADGTYQSTLTWTLSDTPAV"
     MTSRTVKVTT ASLLALGLIV APVLSGDFAS AATFVTKDSK GIVKFDKSTT PDPDPVNPDP        60
     VDPDPVIPDP TDPPVGTDGL WILAVSDWDF GTHNVSSLSS GALNVHAADD TISTYVDANG       120
     NGQQDLPGEV SVTKKVTPYA QISDVRGTNT GWTLSVTGSA FKDSSTPAKT IPGAELTIPK       180
     STVSSATSTA QAPTGYDSVT ISMTGGAAVP VMAAKDMQTA TPTNFNDDQG MGTWTDSFGS       240
     QAVSATDTSK PKLSIPKNVV VADGTYQSTL TWTLSDTPAV                             280
//

If you have problems or comments...

PBIL Back to PBIL home page