(data stored in ACNUC10821 zone)

EMBL: AE017262.PE573

AE017262.PE573       Location/Qualifiers
FT   CDS             596926..597957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06030"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03363"
FT                   /protein_id="AAT03363.1"
FT                   /translation="MKKICAIIFACVLAILCFPGQQAYATENSSFSVKAILSDNQASSV
FT                   TYFDLQMKPKQKQSLNVEITNQSKEEITVNCVANTAVTNEMGYVDYSIPNTKPDKTLKY
FT                   PFADMVKESVSEVTLKPNETKIWTAAIQMPAENYDGIILGGLHFQEKKEEDKEKDSSEN
FT                   DVQIKNEYAYVIGVKLTEKTTVVKPELELNQIKPATRNYRNVVEMNLQNTKATLVGGLA
FT                   VDAKIYKKGSEKVLHESKRTDLSMAPNSNFNYSVDWENQELKPGKYKVHLVAKNKEDKW
FT                   EWTKEFTISSDQAKKANKVALGLEKDYTWMYIVGGVLLFILLIIATYFVGKRAAKKKQE
FT                   NEK"
     MKKICAIIFA CVLAILCFPG QQAYATENSS FSVKAILSDN QASSVTYFDL QMKPKQKQSL        60
     NVEITNQSKE EITVNCVANT AVTNEMGYVD YSIPNTKPDK TLKYPFADMV KESVSEVTLK       120
     PNETKIWTAA IQMPAENYDG IILGGLHFQE KKEEDKEKDS SENDVQIKNE YAYVIGVKLT       180
     EKTTVVKPEL ELNQIKPATR NYRNVVEMNL QNTKATLVGG LAVDAKIYKK GSEKVLHESK       240
     RTDLSMAPNS NFNYSVDWEN QELKPGKYKV HLVAKNKEDK WEWTKEFTIS SDQAKKANKV       300
     ALGLEKDYTW MYIVGGVLLF ILLIIATYFV GKRAAKKKQE NEK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page