(data stored in ACNUC10821 zone)

EMBL: AE017262.PE590

AE017262.PE590       Location/Qualifiers
FT   CDS             complement(612644..613822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0598"
FT                   /product="putative ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /note="identified by similarity to SP:O34459; match to
FT                   protein family HMM PF00587"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03380"
FT                   /db_xref="GOA:Q722Y1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y1"
FT                   /protein_id="AAT03380.1"
FT                   /translation="MNLNKNLPTGTRDKLFREAQAAYKIEQQVNHYFEKRGFKRIETPV
FT                   IEFEDVFSSEHQADAKLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKI
FT                   FRANEDFGGEQNEQTQAGIEIIGYPSIKAEIECILSGIGVLNALEIPNFQIELGHAAIY
FT                   RRVIQLLNLSETAEIDFRQLIQNKSLTGIKRFVANNPSTLDDFILAIPRLFGPATAILN
FT                   QAKSLTTDKGILTALREMETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADN
FT                   FLSGGRYDHLLEQFTSSSSPAVGLALNLDSLTTLQNRAGIIKKQTPTTLLIHYDLEALP
FT                   QAEKFMQETPNSELSFFETASNAISFAKKWHIPEVVHVSSQGIQTILQREVD"
     MNLNKNLPTG TRDKLFREAQ AAYKIEQQVN HYFEKRGFKR IETPVIEFED VFSSEHQADA        60
     KLYRFFDEKG RLTVLRPDMT LPIGRVVSTT GVMLPLKLSY SGKIFRANED FGGEQNEQTQ       120
     AGIEIIGYPS IKAEIECILS GIGVLNALEI PNFQIELGHA AIYRRVIQLL NLSETAEIDF       180
     RQLIQNKSLT GIKRFVANNP STLDDFILAI PRLFGPATAI LNQAKSLTTD KGILTALREM       240
     ETIVEAVSYT ADISVDLGLV QDFHYYTGII FRGYADLAAD NFLSGGRYDH LLEQFTSSSS       300
     PAVGLALNLD SLTTLQNRAG IIKKQTPTTL LIHYDLEALP QAEKFMQETP NSELSFFETA       360
     SNAISFAKKW HIPEVVHVSS QGIQTILQRE VD                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page