(data stored in ACNUC10821 zone)

EMBL: AE017262.PE593

AE017262.PE593       Location/Qualifiers
FT   CDS             615159..616190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0577"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03383"
FT                   /protein_id="AAT03383.1"
FT                   /translation="MPDFSYAKITKLVVHFAGNKAREEGTEVSANVLADIGSEMNQTLA
FT                   SIFLEPFNKDEYYQFTHETDLDFNEVRTFAANMFVAEDEFLDESKKILEHLYSETTHPN
FT                   IKSGDVWIFFIEGCVVDGDFTNGIGIFKVENKEVFLKNDFNGREFQIGYDKGITGTDLD
FT                   KGCLVFNVDHDTGNKVLILDRLNRGDSVYWKDKFLSIDKITDEKFYTEGFVEVCTDYIK
FT                   QREESLLDKSNFVKATSEYLAGEETLNIAEFARTTIEKPEEITEFNTMVDTFERENNVR
FT                   FPETFQLDEEKREKLSKKIRKTIKLGKNISVVVKDLEQLEETDFVQGYDEEKGKNYMIV
FT                   YYD"
     MPDFSYAKIT KLVVHFAGNK AREEGTEVSA NVLADIGSEM NQTLASIFLE PFNKDEYYQF        60
     THETDLDFNE VRTFAANMFV AEDEFLDESK KILEHLYSET THPNIKSGDV WIFFIEGCVV       120
     DGDFTNGIGI FKVENKEVFL KNDFNGREFQ IGYDKGITGT DLDKGCLVFN VDHDTGNKVL       180
     ILDRLNRGDS VYWKDKFLSI DKITDEKFYT EGFVEVCTDY IKQREESLLD KSNFVKATSE       240
     YLAGEETLNI AEFARTTIEK PEEITEFNTM VDTFERENNV RFPETFQLDE EKREKLSKKI       300
     RKTIKLGKNI SVVVKDLEQL EETDFVQGYD EEKGKNYMIV YYD                         343
//

If you have problems or comments...

PBIL Back to PBIL home page