(data stored in ACNUC10821 zone)

EMBL: AE017262.PE594

AE017262.PE594       Location/Qualifiers
FT   CDS             complement(616233..617528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0602"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03384"
FT                   /protein_id="AAT03384.1"
FT                   /translation="MDKFFKLRENKTTVRTEILAGLTTFLSMAYVLFVNPSMLATTGME
FT                   LKAVFVATILASVVGSLAMGLIANYPIGLAPGMGLNAFFAYTVCAQWGIPWQTALAGVL
FT                   VSGLVFICLTISGLREKIVNAIPTELKFAVGAGIGFFIAFLGLKNAGIIVPNESTIVAL
FT                   GDLHSGPVLLAVFGIVVTVAYMTIGWKGAIFFGMATTAVAGMLFGLIDVPTQVVSSVPS
FT                   MESTFGQAIIHLPDIFTPQMLIVILTFFFIDFFDTAGTLVAVATQAGFVKDNKIPRAGR
FT                   SLFSDSLATVFGAIFGTSTTTSYVESTAGVAVGGRTGLTAVVIAICFSLSLFFSPLLGV
FT                   ITSAVTTPALVIVGILMIGNVAHIDWTKFEVAVPSFFVILMMVLTFSIATGIAIGFIFY
FT                   PITMVLKGRYKEVHPIMYVMMVLFILYFMFVV"
     MDKFFKLREN KTTVRTEILA GLTTFLSMAY VLFVNPSMLA TTGMELKAVF VATILASVVG        60
     SLAMGLIANY PIGLAPGMGL NAFFAYTVCA QWGIPWQTAL AGVLVSGLVF ICLTISGLRE       120
     KIVNAIPTEL KFAVGAGIGF FIAFLGLKNA GIIVPNESTI VALGDLHSGP VLLAVFGIVV       180
     TVAYMTIGWK GAIFFGMATT AVAGMLFGLI DVPTQVVSSV PSMESTFGQA IIHLPDIFTP       240
     QMLIVILTFF FIDFFDTAGT LVAVATQAGF VKDNKIPRAG RSLFSDSLAT VFGAIFGTST       300
     TTSYVESTAG VAVGGRTGLT AVVIAICFSL SLFFSPLLGV ITSAVTTPAL VIVGILMIGN       360
     VAHIDWTKFE VAVPSFFVIL MMVLTFSIAT GIAIGFIFYP ITMVLKGRYK EVHPIMYVMM       420
     VLFILYFMFV V                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page