(data stored in ACNUC10821 zone)

EMBL: AE017262.PE596

AE017262.PE596       Location/Qualifiers
FT   CDS             619282..620010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0604"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03386"
FT                   /protein_id="AAT03386.1"
FT                   /translation="MAQNQTKYSFIAEEIRKRIMNHAYPLNQPIPDEITLAKEFDCSRM
FT                   TMKKALEVLVLEGLLYRKRGHGTFIIKSALDADRLQIHNQEVNGFTKLLNGKKVISKVI
FT                   EFKVIFPTEEIAERLHIEMETPIYDILRVRLVKDEPYVLEHTYMPVGVIPGINQQILEG
FT                   SIYSYIQDDLNLKIASSYKQIRADKATLLDQQYLDCASDDPVVEVEQTVYLNNGLAFEF
FT                   SKSRHRYDKFVFTTVNIARR"
     MAQNQTKYSF IAEEIRKRIM NHAYPLNQPI PDEITLAKEF DCSRMTMKKA LEVLVLEGLL        60
     YRKRGHGTFI IKSALDADRL QIHNQEVNGF TKLLNGKKVI SKVIEFKVIF PTEEIAERLH       120
     IEMETPIYDI LRVRLVKDEP YVLEHTYMPV GVIPGINQQI LEGSIYSYIQ DDLNLKIASS       180
     YKQIRADKAT LLDQQYLDCA SDDPVVEVEQ TVYLNNGLAF EFSKSRHRYD KFVFTTVNIA       240
     RR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page