(data stored in ACNUC10821 zone)

EMBL: AE017262.PE599

AE017262.PE599       Location/Qualifiers
FT   CDS             complement(622449..623201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0583; match
FT                   to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03389"
FT                   /protein_id="AAT03389.1"
FT                   /translation="MSTETTDYLLETCLMAGKIMMESGAEMYRVEDTMNRIATIASNKK
FT                   GISFVTPTGLFMSLEGERNVQLQQIPTRTINLEKVSMVNEFSRDFAEKRISLKELHTKL
FT                   VNLDKDVRYFPIWLQIIAASLVSGSLMVIFGGGWFDFIPTCIIGAIGFIIFYYTQIFMK
FT                   VKFLAEFLASLSVGLLAVLTISIGWGINLDTMIIGGVMPLVPGVPITNAVRDLIAGHLL
FT                   SGMARGTEALLTSCAIGIGIAVVFRFFL"
     MSTETTDYLL ETCLMAGKIM MESGAEMYRV EDTMNRIATI ASNKKGISFV TPTGLFMSLE        60
     GERNVQLQQI PTRTINLEKV SMVNEFSRDF AEKRISLKEL HTKLVNLDKD VRYFPIWLQI       120
     IAASLVSGSL MVIFGGGWFD FIPTCIIGAI GFIIFYYTQI FMKVKFLAEF LASLSVGLLA       180
     VLTISIGWGI NLDTMIIGGV MPLVPGVPIT NAVRDLIAGH LLSGMARGTE ALLTSCAIGI       240
     GIAVVFRFFL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page