(data stored in ACNUC10821 zone)

EMBL: AE017262.PE601

AE017262.PE601       Location/Qualifiers
FT   CDS             623591..624253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0609"
FT                   /product="phospholipase/carboxylesterase family protein"
FT                   /note="identified by match to protein family HMM PF02230"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03391"
FT                   /protein_id="AAT03391.1"
FT                   /translation="MRMFAYDIYEPIGRKDEDTFPVIFALHGFGGDELEMAGRLELLMD
FT                   RFVVVSMRGDVEYGPAYGFYHMVTEGDPNPQEVDYISLRVAQFIDKICTDYISIDKEQV
FT                   FLAGFDQGAVLTISIMQSYGGQYKAAALLSGRLPYYMEERPANLMLKDKRIFIGHGIED
FT                   AVIQISEADDIARLFEKMGCHVEKHRYFIGHNVNEAEEDDLYRWFESFLPNQPVKNK"
     MRMFAYDIYE PIGRKDEDTF PVIFALHGFG GDELEMAGRL ELLMDRFVVV SMRGDVEYGP        60
     AYGFYHMVTE GDPNPQEVDY ISLRVAQFID KICTDYISID KEQVFLAGFD QGAVLTISIM       120
     QSYGGQYKAA ALLSGRLPYY MEERPANLML KDKRIFIGHG IEDAVIQISE ADDIARLFEK       180
     MGCHVEKHRY FIGHNVNEAE EDDLYRWFES FLPNQPVKNK                             220
//

If you have problems or comments...

PBIL Back to PBIL home page