(data stored in ACNUC10821 zone)

EMBL: AE017262.PE602

AE017262.PE602       Location/Qualifiers
FT   CDS             complement(624284..625468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0610"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0586"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03392"
FT                   /protein_id="AAT03392.1"
FT                   /translation="MKNLVKVKVFPKFTKGYKEGYPLILKERMEKWPKELQEGDVLELT
FT                   DTNGQFIARGYHGEQNKGSGWLFTWDKKQQLDEDFLTNLITTAIEKRQFLFADDSTTAF
FT                   RIFNGEGDGLGGFTVDFYDDYLVIQWYSLGIYAFQKMIIDIFLSFPEIKGIYEKRRFQE
FT                   DTKDDFVAGQKATFPLIIKENGINYATYLDDGWMTGIFLDQRDVRRRISEDYSVSKNVL
FT                   NTFSYTGAFSVAALFGGASKTTSVDVAGRSLSKTKEQLEVNGLDPNEQAIIVEDVFHYF
FT                   KYAARKQLTFDLVVVDPPSFARTKKVTFRAAKDYPAMLREIIDITAPNGTIIASTNYAG
FT                   FGMKAFKKLIAEAFQTSDRTYKIVETHSLPADFTVNKNFPEGNYLKVLFLTLDI"
     MKNLVKVKVF PKFTKGYKEG YPLILKERME KWPKELQEGD VLELTDTNGQ FIARGYHGEQ        60
     NKGSGWLFTW DKKQQLDEDF LTNLITTAIE KRQFLFADDS TTAFRIFNGE GDGLGGFTVD       120
     FYDDYLVIQW YSLGIYAFQK MIIDIFLSFP EIKGIYEKRR FQEDTKDDFV AGQKATFPLI       180
     IKENGINYAT YLDDGWMTGI FLDQRDVRRR ISEDYSVSKN VLNTFSYTGA FSVAALFGGA       240
     SKTTSVDVAG RSLSKTKEQL EVNGLDPNEQ AIIVEDVFHY FKYAARKQLT FDLVVVDPPS       300
     FARTKKVTFR AAKDYPAMLR EIIDITAPNG TIIASTNYAG FGMKAFKKLI AEAFQTSDRT       360
     YKIVETHSLP ADFTVNKNFP EGNYLKVLFL TLDI                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page