(data stored in ACNUC10821 zone)

EMBL: AE017262.PE608

AE017262.PE608       Location/Qualifiers
FT   CDS             633108..635573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16413036"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03398"
FT                   /protein_id="AAT03398.1"
FT                   /translation="MAFKKLILVLTIAALFLGFKIVVAAENGSRDLASNEAIVTNFTEL
FT                   KTAISEDNGIDTVYLGADVELSGGIIIPATKKTFTLSGKNPTTGEIHTLTETMASAGAQ
FT                   SSVITVNTNTGAKETTLRDINVVGKNYYGTISVYGAAKNVVQNYENVHYQGPQMIYNLN
FT                   GTANFKGTNDITIASVVSGSAAPNEVAEIKGVSVSGKLNINHASSNANSAFWFGGGTAE
FT                   VNTFTVEENADVTILSNGTGMFYRSGAKPIDIDVKKNAKLAITSNNNIFRDTPGGAVKI
FT                   ASGADVTMTKTAGGNPLLWVADDITVSPDARFILNKTGGTGYIIQFYNATAKLDINDPR
FT                   SFLITTNSNTPMFYWPYANTFNLNAQMVNYWDTVGTIDRTDLASQSFSLPNGENVTGSL
FT                   TYTGTTTKILSTNTGMTPTNFNQNTARMIAMGRLEGTINPVTDADNEITGTATPNAFIS
FT                   ISYTENGENKVLEGQSNEAGTYRIAIPNGFIKPYIKLTTTIKQDQKRITLDDITVEDVT
FT                   PPSGEAVTQIIQLGDPFPDVAELVTNIYDHSDNTSGAGVTTTLQSAPDTNVFGPTEAIV
FT                   RLEDKAQNYVDIRVPVFIKDDETEIQDGKALRAADFSVNVKDIIELNDAELEQFILSKS
FT                   GAKAFNIETGEDLSAELKVASTNLKKETGTYAATIQIDGLTKEIAIQVTGELKFNHVPE
FT                   TISFETMELNQQKNIAKRNADFDLSVLDSRGSGGKFSVTATVKTPLTSTTNSAHTLPNG
FT                   LIFIDNTGAKKILSAEPITIFESQSASEMIVPIEWAEDQGILVEVDAAEAYVDESYETT
FT                   IEWTLTDAP"
     MAFKKLILVL TIAALFLGFK IVVAAENGSR DLASNEAIVT NFTELKTAIS EDNGIDTVYL        60
     GADVELSGGI IIPATKKTFT LSGKNPTTGE IHTLTETMAS AGAQSSVITV NTNTGAKETT       120
     LRDINVVGKN YYGTISVYGA AKNVVQNYEN VHYQGPQMIY NLNGTANFKG TNDITIASVV       180
     SGSAAPNEVA EIKGVSVSGK LNINHASSNA NSAFWFGGGT AEVNTFTVEE NADVTILSNG       240
     TGMFYRSGAK PIDIDVKKNA KLAITSNNNI FRDTPGGAVK IASGADVTMT KTAGGNPLLW       300
     VADDITVSPD ARFILNKTGG TGYIIQFYNA TAKLDINDPR SFLITTNSNT PMFYWPYANT       360
     FNLNAQMVNY WDTVGTIDRT DLASQSFSLP NGENVTGSLT YTGTTTKILS TNTGMTPTNF       420
     NQNTARMIAM GRLEGTINPV TDADNEITGT ATPNAFISIS YTENGENKVL EGQSNEAGTY       480
     RIAIPNGFIK PYIKLTTTIK QDQKRITLDD ITVEDVTPPS GEAVTQIIQL GDPFPDVAEL       540
     VTNIYDHSDN TSGAGVTTTL QSAPDTNVFG PTEAIVRLED KAQNYVDIRV PVFIKDDETE       600
     IQDGKALRAA DFSVNVKDII ELNDAELEQF ILSKSGAKAF NIETGEDLSA ELKVASTNLK       660
     KETGTYAATI QIDGLTKEIA IQVTGELKFN HVPETISFET MELNQQKNIA KRNADFDLSV       720
     LDSRGSGGKF SVTATVKTPL TSTTNSAHTL PNGLIFIDNT GAKKILSAEP ITIFESQSAS       780
     EMIVPIEWAE DQGILVEVDA AEAYVDESYE TTIEWTLTDA P                           821
//

If you have problems or comments...

PBIL Back to PBIL home page