(data stored in ACNUC10821 zone)

EMBL: AE017262.PE611

AE017262.PE611       Location/Qualifiers
FT   CDS             637639..639408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0619"
FT                   /product="DAK2 domain protein"
FT                   /note="identified by similarity to GP:16413039; match to
FT                   protein family HMM PF02645; match to protein family HMM
FT                   PF02734"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03401"
FT                   /protein_id="AAT03401.1"
FT                   /translation="MMESESKRLLQSMLNGAAEVISKKDELNRINVFPVADGDTGSNLA
FT                   SLMQAIIDHVSPREYSTKELLEEVASAALIGARGNSGMIFAQYLNAVAESYHHLESTFD
FT                   GLVQAFQNAVHKAYEALLDPKEGTILSVMKAWSEELAGTYEQERSFQQSLLNAQIVAEK
FT                   ALINTEFQMPILRKNRLVDSGAKGFYYFITGLTNAYCGKAVSDPVRFTEVEQTAEHRHV
FT                   ETSEPKYRYCSEFIIKQATISHQHLQEILAAKGDSLVIAGNEKQIKIHIHTNEPKEVLS
FT                   LMAAYGVMTYQKVDDMRLQYEVTKKPRAKIAIVTDSIADLPEAFLLEHQVHVLPMNILA
FT                   GEENFLDKLTVGPNMMQEKLRKQTKMSTAQPTIRTVDALLSFLEHKYEHVLVISVAAKL
FT                   SGTYQLIKQRIKARELSSDWIRVIDSKLNSVAQGILVKQAVELVESGKSWESIYPEVEQ
FT                   MIERTFIYVAVADLSPMVQSGRIPRVLGKLAQKLSLYPIVSLDESGDGKLIGVSFSQKQ
FT                   SMKKIIKKIAKLQLKELAITHVSSRDTAAIWQKQLEKETGEISYLVDSSAAIAISAGLG
FT                   SVAVAGIKKEETI"
     MMESESKRLL QSMLNGAAEV ISKKDELNRI NVFPVADGDT GSNLASLMQA IIDHVSPREY        60
     STKELLEEVA SAALIGARGN SGMIFAQYLN AVAESYHHLE STFDGLVQAF QNAVHKAYEA       120
     LLDPKEGTIL SVMKAWSEEL AGTYEQERSF QQSLLNAQIV AEKALINTEF QMPILRKNRL       180
     VDSGAKGFYY FITGLTNAYC GKAVSDPVRF TEVEQTAEHR HVETSEPKYR YCSEFIIKQA       240
     TISHQHLQEI LAAKGDSLVI AGNEKQIKIH IHTNEPKEVL SLMAAYGVMT YQKVDDMRLQ       300
     YEVTKKPRAK IAIVTDSIAD LPEAFLLEHQ VHVLPMNILA GEENFLDKLT VGPNMMQEKL       360
     RKQTKMSTAQ PTIRTVDALL SFLEHKYEHV LVISVAAKLS GTYQLIKQRI KARELSSDWI       420
     RVIDSKLNSV AQGILVKQAV ELVESGKSWE SIYPEVEQMI ERTFIYVAVA DLSPMVQSGR       480
     IPRVLGKLAQ KLSLYPIVSL DESGDGKLIG VSFSQKQSMK KIIKKIAKLQ LKELAITHVS       540
     SRDTAAIWQK QLEKETGEIS YLVDSSAAIA ISAGLGSVAV AGIKKEETI                   589
//

If you have problems or comments...

PBIL Back to PBIL home page