(data stored in ACNUC10821 zone)

EMBL: AE017262.PE613

AE017262.PE613       Location/Qualifiers
FT   CDS             640306..640848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0597"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03403"
FT                   /protein_id="AAT03403.1"
FT                   /translation="MKKEKTVLIMNFDEESISYQAFSEMKRLHQERKIIGYQMAVVKHE
FT                   PGNKLVAQDFLDFTGADKNMKDSLIGMLIGILGGPFGILIGWMVGAIVGSMRDAGEVKD
FT                   ALNVFERTLKTIPEGSTGVILIATEQELANVNDVAMDELHGRVQRMDEAIVAQEIKSAQ
FT                   ETEGKAKDSAKKHWFSK"
     MKKEKTVLIM NFDEESISYQ AFSEMKRLHQ ERKIIGYQMA VVKHEPGNKL VAQDFLDFTG        60
     ADKNMKDSLI GMLIGILGGP FGILIGWMVG AIVGSMRDAG EVKDALNVFE RTLKTIPEGS       120
     TGVILIATEQ ELANVNDVAM DELHGRVQRM DEAIVAQEIK SAQETEGKAK DSAKKHWFSK       180
//

If you have problems or comments...

PBIL Back to PBIL home page