(data stored in ACNUC10821 zone)

EMBL: AE017262.PE618

AE017262.PE618       Location/Qualifiers
FT   CDS             complement(645376..646077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0626"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03408"
FT                   /protein_id="AAT03408.1"
FT                   /translation="MSLLNEENSFYNVDLLNLLKDSSEAVLPYKRIRFRRNQQILAEGA
FT                   ETDYFYIIEDGVVSMSKNTCKEDSIINFLGKQECIGPLTLLGGAKSPVNYTTISEVSVY
FT                   QFERKYVLNKFLSSPDVFWQMNALMQSMVTPMLEREGYVNLPSSEKVLAGLIACGERFG
FT                   RIESDGSCLIPYYFTQKILGNYLNLARAYVATNLRKLEEDGIIALSPKPWRVNNFEIHK
FT                   QKLKENHEPYI"
     MSLLNEENSF YNVDLLNLLK DSSEAVLPYK RIRFRRNQQI LAEGAETDYF YIIEDGVVSM        60
     SKNTCKEDSI INFLGKQECI GPLTLLGGAK SPVNYTTISE VSVYQFERKY VLNKFLSSPD       120
     VFWQMNALMQ SMVTPMLERE GYVNLPSSEK VLAGLIACGE RFGRIESDGS CLIPYYFTQK       180
     ILGNYLNLAR AYVATNLRKL EEDGIIALSP KPWRVNNFEI HKQKLKENHE PYI              233
//

If you have problems or comments...

PBIL Back to PBIL home page