(data stored in ACNUC10821 zone)

EMBL: AE017262.PE619

AE017262.PE619       Location/Qualifiers
FT   CDS             complement(646153..646701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0627"
FT                   /product="BioY family protein"
FT                   /note="identified by match to protein family HMM PF02632"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03409"
FT                   /protein_id="AAT03409.1"
FT                   /translation="MRDQKLKFLVVDALFAVIIALLAQVAIPLGPIPLTGQTFAIGLAA
FT                   TILGARHGTISVLVYIVLGAVGIPVFQGMTAGIGILFGPTGGFIVGFIFNALLTGWLLE
FT                   KTKFTVPYAIVANILGAIVTLIFGVLWLKVSTGLDWPTAFLTGMVPFIIPGIIKAVFAA
FT                   LLGILIRDRLIKAKLLRAS"
     MRDQKLKFLV VDALFAVIIA LLAQVAIPLG PIPLTGQTFA IGLAATILGA RHGTISVLVY        60
     IVLGAVGIPV FQGMTAGIGI LFGPTGGFIV GFIFNALLTG WLLEKTKFTV PYAIVANILG       120
     AIVTLIFGVL WLKVSTGLDW PTAFLTGMVP FIIPGIIKAV FAALLGILIR DRLIKAKLLR       180
     AS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page