(data stored in ACNUC10821 zone)

EMBL: AE017262.PE620

AE017262.PE620       Location/Qualifiers
FT   CDS             646895..647227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0628"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03410"
FT                   /protein_id="AAT03410.1"
FT                   /translation="MEVNPQFKKGVLELCCLFLIQKKDCYGYELANQVSKYIEVAEGAI
FT                   YPVLRRLVKEEYCSTYLVESNEGPSRKYYQLTVKGEIYLNELISEWNNFTDSVAKLLTE
FT                   GDAVNE"
     MEVNPQFKKG VLELCCLFLI QKKDCYGYEL ANQVSKYIEV AEGAIYPVLR RLVKEEYCST        60
     YLVESNEGPS RKYYQLTVKG EIYLNELISE WNNFTDSVAK LLTEGDAVNE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page