(data stored in ACNUC10821 zone)

EMBL: AE017262.PE621

AE017262.PE621       Location/Qualifiers
FT   CDS             647220..647810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0605; match
FT                   to protein family HMM PF08006"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03411"
FT                   /protein_id="AAT03411.1"
FT                   /translation="MNKQDFLNELNQRLELLDPKERRELLSDYQEHFRNGIEAGKSEEQ
FT                   IVFDLGSPEEIAADIISERGIREEPAEMDYYYVPRKNQNENRSVSKQILIGVGLFFLDI
FT                   CLIIPIMVSLWSLVISLWATVGGFLLSPVILGVGIIFGADFEFYQMFVSIGLVGLGLML
FT                   LFVANALTQLTSKVTMAIIQWHKYAVKGGGKNA"
     MNKQDFLNEL NQRLELLDPK ERRELLSDYQ EHFRNGIEAG KSEEQIVFDL GSPEEIAADI        60
     ISERGIREEP AEMDYYYVPR KNQNENRSVS KQILIGVGLF FLDICLIIPI MVSLWSLVIS       120
     LWATVGGFLL SPVILGVGII FGADFEFYQM FVSIGLVGLG LMLLFVANAL TQLTSKVTMA       180
     IIQWHKYAVK GGGKNA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page