(data stored in ACNUC10821 zone)

EMBL: AE017262.PE623

AE017262.PE623       Location/Qualifiers
FT   CDS             649009..649509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0631"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:NTL01LI0607; match
FT                   to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03413"
FT                   /protein_id="AAT03413.1"
FT                   /translation="MNFHIRKATNSDAEAIQHVAITSWHHTYQDLIPGDVQDDFLERFY
FT                   NVETLHNRISATPFAVVEQADKVIGFANFIELEKGKSELAAFYLLPEVTQRGLGTELLE
FT                   VGMTLFHVPLPMFVNVEKGNETAIHFYKAKGFVQVEEFTEDFYGYPLETIRFNLNHHAF
FT                   EEE"
     MNFHIRKATN SDAEAIQHVA ITSWHHTYQD LIPGDVQDDF LERFYNVETL HNRISATPFA        60
     VVEQADKVIG FANFIELEKG KSELAAFYLL PEVTQRGLGT ELLEVGMTLF HVPLPMFVNV       120
     EKGNETAIHF YKAKGFVQVE EFTEDFYGYP LETIRFNLNH HAFEEE                      166
//

If you have problems or comments...

PBIL Back to PBIL home page