(data stored in ACNUC10821 zone)

EMBL: AE017262.PE624

AE017262.PE624       Location/Qualifiers
FT   CDS             complement(649557..649943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0608"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03414"
FT                   /protein_id="AAT03414.1"
FT                   /translation="MRFIIAYLSIFVLGIFSTLLVETILYDNVTPQLVFSAILFAAPVI
FT                   LVASTLGEIFYGFSKKASYFTFAIWGFAYGVVAAVIILSIIQVSGMLISVGVSILAGVI
FT                   MALLAIIFFFLRGGKSTSGKAATK"
     MRFIIAYLSI FVLGIFSTLL VETILYDNVT PQLVFSAILF AAPVILVAST LGEIFYGFSK        60
     KASYFTFAIW GFAYGVVAAV IILSIIQVSG MLISVGVSIL AGVIMALLAI IFFFLRGGKS       120
     TSGKAATK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page