(data stored in ACNUC10821 zone)

EMBL: AE017262.PE625

AE017262.PE625       Location/Qualifiers
FT   CDS             complement(649997..650341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0633"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03415"
FT                   /protein_id="AAT03415.1"
FT                   /translation="MLDKKIISALSYFSLFFAPVITPAIIWCTTKDKEIRHHVRWALLT
FT                   QTTFVAGVVVMILLYNNVPFSTNSADTINFLALATVFFIVFLNVSILIFNLIRRITRIV
FT                   KHSDDNWARC"
     MLDKKIISAL SYFSLFFAPV ITPAIIWCTT KDKEIRHHVR WALLTQTTFV AGVVVMILLY        60
     NNVPFSTNSA DTINFLALAT VFFIVFLNVS ILIFNLIRRI TRIVKHSDDN WARC             114
//

If you have problems or comments...

PBIL Back to PBIL home page