(data stored in ACNUC10821 zone)

EMBL: AE017262.PE630

AE017262.PE630       Location/Qualifiers
FT   CDS             656120..656419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0638"
FT                   /product="rhodanese-like domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03420"
FT                   /protein_id="AAT03420.1"
FT                   /translation="MYQSITANDLEQDLKKASHNILDVRDADAFVEGHIPDAINIPINE
FT                   LPEKLASLDKEKPYTIICYAGGRSERASQFLAAEGFDVTNVMGGMGAFHGRVTK"
     MYQSITANDL EQDLKKASHN ILDVRDADAF VEGHIPDAIN IPINELPEKL ASLDKEKPYT        60
     IICYAGGRSE RASQFLAAEG FDVTNVMGGM GAFHGRVTK                               99
//

If you have problems or comments...

PBIL Back to PBIL home page