(data stored in ACNUC10821 zone)

EMBL: AE017262.PE631

AE017262.PE631       Location/Qualifiers
FT   CDS             complement(656462..658231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0639"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF00560;
FT                   match to protein family HMM PF00746; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03421"
FT                   /protein_id="AAT03421.1"
FT                   /translation="MRKMGVKIGLCVLLMMPFTISFSANVSAEEEISVKAAQDVVNIPD
FT                   PVLKSYLNGLLGQSSTSDITEAQMDTITNVTISNSSLTDLTGLDYAHNLTILHLSNTGV
FT                   TDYALVAKIPSLTNLSIAGDNLTNDSLPDLNNLSNITNLNLSPGKLDNNALTKFNKMSK
FT                   LSYLNLDSNPSITNIMPLKSIPNLATLFVQFCGINDFRGIDTFPKLVSLSAYGQNVGRT
FT                   VLINSSIKSSALNFDEANQTIFVPFTLMTERGVNFDGYLFPFTTNTSSASTYFTLNETK
FT                   IDGSRLTIDDKGITVSGITKSYFDTITKMEYNALYNNPAGSYQTPPNFNNYSVSGGSYD
FT                   HYFDIDHSLTITNDSAISYGEQTTVTEEQFLKDVHAETDDGTPVTSDFNTVVDFSKPGV
FT                   YTVTLNAENAAGLKATPTQVTVTIHAKPVITADKSISYTKDSTKTDQQFLQDISAKTSD
FT                   GSKVTSDFDSVVDLAKVGTYKVTLNAVSADGLNADPVIVLVNVVEGNEPPTPPAPGPDP
FT                   TPDPTPNPNNPNINPNPDNGQSANSENASNPSNSEVNAALPNTGDASQATTVLIGIIIA
FT                   GVAILFFRQRKHS"
     MRKMGVKIGL CVLLMMPFTI SFSANVSAEE EISVKAAQDV VNIPDPVLKS YLNGLLGQSS        60
     TSDITEAQMD TITNVTISNS SLTDLTGLDY AHNLTILHLS NTGVTDYALV AKIPSLTNLS       120
     IAGDNLTNDS LPDLNNLSNI TNLNLSPGKL DNNALTKFNK MSKLSYLNLD SNPSITNIMP       180
     LKSIPNLATL FVQFCGINDF RGIDTFPKLV SLSAYGQNVG RTVLINSSIK SSALNFDEAN       240
     QTIFVPFTLM TERGVNFDGY LFPFTTNTSS ASTYFTLNET KIDGSRLTID DKGITVSGIT       300
     KSYFDTITKM EYNALYNNPA GSYQTPPNFN NYSVSGGSYD HYFDIDHSLT ITNDSAISYG       360
     EQTTVTEEQF LKDVHAETDD GTPVTSDFNT VVDFSKPGVY TVTLNAENAA GLKATPTQVT       420
     VTIHAKPVIT ADKSISYTKD STKTDQQFLQ DISAKTSDGS KVTSDFDSVV DLAKVGTYKV       480
     TLNAVSADGL NADPVIVLVN VVEGNEPPTP PAPGPDPTPD PTPNPNNPNI NPNPDNGQSA       540
     NSENASNPSN SEVNAALPNT GDASQATTVL IGIIIAGVAI LFFRQRKHS                   589
//

If you have problems or comments...

PBIL Back to PBIL home page