(data stored in ACNUC10821 zone)

EMBL: AE017262.PE633

AE017262.PE633       Location/Qualifiers
FT   CDS             659187..659636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0641"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03423"
FT                   /protein_id="AAT03423.1"
FT                   /translation="MGVKTLKPCTEQSELLYRMHLLSKEISHVFEQQTNMSFTKVEILF
FT                   HIQQTPGQSQNRLREKLYIDSASITRHLKRMEAQGLIVRKKQDENKRYTYLFLTSAGEA
FT                   ELATLLLEKEKFQNGALEAFSEEEVSALLKSVTKMMNNVEKMEEK"
     MGVKTLKPCT EQSELLYRMH LLSKEISHVF EQQTNMSFTK VEILFHIQQT PGQSQNRLRE        60
     KLYIDSASIT RHLKRMEAQG LIVRKKQDEN KRYTYLFLTS AGEAELATLL LEKEKFQNGA       120
     LEAFSEEEVS ALLKSVTKMM NNVEKMEEK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page