(data stored in ACNUC10821 zone)

EMBL: AE017262.PE634

AE017262.PE634       Location/Qualifiers
FT   CDS             659639..660580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0642"
FT                   /product="alcohol dehydrogenase, zinc-dependent"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03424"
FT                   /protein_id="AAT03424.1"
FT                   /translation="MKAVVIENYGGKEELKEKEVAMPKAGKNQVIVKEAATSINPIDWK
FT                   LREGYLKQMMDWEFPIILGWDVAGVISEVGEGVTDWKVGDEVFARPETTRFGTYAEYTA
FT                   VDDHLLAPLPEGISFDEAASIPLAGLTAWQALFDHAKLQKGEKVLIHAGAGGVGTLAIQ
FT                   LAKHAGAEVITTASAKNHELLKSLGADQVIDYKEVNFKDVLSDIDVVFDTMGGQIETDS
FT                   YDVLKEGTGRLVSIVGISNEERAKEKNVTATGIWLQPNGEQLKELGKLLANKTVKPIVG
FT                   ATFPFSEKGVFDAHALSETHHAVGKIVISFNK"
     MKAVVIENYG GKEELKEKEV AMPKAGKNQV IVKEAATSIN PIDWKLREGY LKQMMDWEFP        60
     IILGWDVAGV ISEVGEGVTD WKVGDEVFAR PETTRFGTYA EYTAVDDHLL APLPEGISFD       120
     EAASIPLAGL TAWQALFDHA KLQKGEKVLI HAGAGGVGTL AIQLAKHAGA EVITTASAKN       180
     HELLKSLGAD QVIDYKEVNF KDVLSDIDVV FDTMGGQIET DSYDVLKEGT GRLVSIVGIS       240
     NEERAKEKNV TATGIWLQPN GEQLKELGKL LANKTVKPIV GATFPFSEKG VFDAHALSET       300
     HHAVGKIVIS FNK                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page