(data stored in ACNUC10821 zone)

EMBL: AE017262.PE635

AE017262.PE635       Location/Qualifiers
FT   CDS             660675..661208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0643"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by similarity to OMNI:EF0951; match to
FT                   protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03425"
FT                   /protein_id="AAT03425.1"
FT                   /translation="MEIRELKNGQIIMIREATKEDSSNIITYLNEVAGETDYLSFGQGE
FT                   FAFSIAEEAEYIEENDKNPGSVMLLCFIDDELASISQLMGHMKKRELHTSELAISIRKK
FT                   YWGLGIGTICMGELIKYAKSSEYLKLIYLEAVSENKRAINLYKKFGFIEAGEIPALMQV
FT                   DSRYLDVTMMYLVI"
     MEIRELKNGQ IIMIREATKE DSSNIITYLN EVAGETDYLS FGQGEFAFSI AEEAEYIEEN        60
     DKNPGSVMLL CFIDDELASI SQLMGHMKKR ELHTSELAIS IRKKYWGLGI GTICMGELIK       120
     YAKSSEYLKL IYLEAVSENK RAINLYKKFG FIEAGEIPAL MQVDSRYLDV TMMYLVI          177
//

If you have problems or comments...

PBIL Back to PBIL home page