(data stored in ACNUC10821 zone)

EMBL: AE017262.PE639

AE017262.PE639       Location/Qualifiers
FT   CDS             complement(663918..665060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0647"
FT                   /product="protein kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03429"
FT                   /protein_id="AAT03429.1"
FT                   /translation="MGEMTLAFIEEQYKELDNLNNKENPAVLTRNTSTGELFVRKIIPS
FT                   SFAPVIEQLKDLSSKYLPKIEVMIPNGNQLIVYEEYINGKNLADLMKANATFEADEVTR
FT                   LMLMLSDALTELHANAIIHRDIKPSNIMISSDGVLKLIDFDASRVFEVGKNQDTVNLGT
FT                   IGYAAPEQYGYSQTDVRSDIYSIGVLMLELLLGKNTLPDKEHATSLEKIAMQAAAFDPE
FT                   QRYQSIQDFRTAVKNDSLGPSYVSELSDFTELDNFSTESDWENVSADYEKDFVPWYKHI
FT                   PGFRTGTPWKMIVGVLGYIFLLFGLFTPPTEGVKMSPIVNFFNNFFLIVPAFVIFTNLC
FT                   GIWSKLPLLKSSSPGTRKAGIVIYIIVCVSIYGIYNEIFS"
     MGEMTLAFIE EQYKELDNLN NKENPAVLTR NTSTGELFVR KIIPSSFAPV IEQLKDLSSK        60
     YLPKIEVMIP NGNQLIVYEE YINGKNLADL MKANATFEAD EVTRLMLMLS DALTELHANA       120
     IIHRDIKPSN IMISSDGVLK LIDFDASRVF EVGKNQDTVN LGTIGYAAPE QYGYSQTDVR       180
     SDIYSIGVLM LELLLGKNTL PDKEHATSLE KIAMQAAAFD PEQRYQSIQD FRTAVKNDSL       240
     GPSYVSELSD FTELDNFSTE SDWENVSADY EKDFVPWYKH IPGFRTGTPW KMIVGVLGYI       300
     FLLFGLFTPP TEGVKMSPIV NFFNNFFLIV PAFVIFTNLC GIWSKLPLLK SSSPGTRKAG       360
     IVIYIIVCVS IYGIYNEIFS                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page