(data stored in ACNUC10821 zone)

EMBL: AE017262.PE641

AE017262.PE641       Location/Qualifiers
FT   CDS             665678..666070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0649"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0625"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03431"
FT                   /protein_id="AAT03431.1"
FT                   /translation="MINEQTILQAATSEKNAGDFPKVVQSFKELGVTKYQFLVEKGIYV
FT                   FWDEMDNQVESKLNGVSMPISEEISRDRLKDAIKQAQAGKIDFEIFIKLAGLAGVRLWE
FT                   ADLSAMKVTYIDNTGNDLIVEPIPSI"
     MINEQTILQA ATSEKNAGDF PKVVQSFKEL GVTKYQFLVE KGIYVFWDEM DNQVESKLNG        60
     VSMPISEEIS RDRLKDAIKQ AQAGKIDFEI FIKLAGLAGV RLWEADLSAM KVTYIDNTGN       120
     DLIVEPIPSI                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page