(data stored in ACNUC10821 zone)

EMBL: AE017262.PE642

AE017262.PE642       Location/Qualifiers
FT   CDS             666167..666907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0650"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0626; match
FT                   to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03432"
FT                   /protein_id="AAT03432.1"
FT                   /translation="MDIITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFS
FT                   SALTVFTMAIFTCSIYYKRKQGNVGLALKIAVTSIPTTFLGAMVNQMLPEAVYRFLYGA
FT                   LIVVLLGIMIWKKKRHNEKPHFLSEYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLI
FT                   FMLNQKTASATSSYVTLLTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLL
FT                   DEKWIAILFNVLLIALFALNLIKI"
     MDIITYFLIA LSTSVVGSFL GIGGGVILLP ILLLMGVSQG TAAFSSALTV FTMAIFTCSI        60
     YYKRKQGNVG LALKIAVTSI PTTFLGAMVN QMLPEAVYRF LYGALIVVLL GIMIWKKKRH       120
     NEKPHFLSEY RIIPYVFGVI IGFLAGLFGI GGGPIVIPIL LLIFMLNQKT ASATSSYVTL       180
     LTSLASIGSY AIIGGSDFSI GIYMIPGAII GALIGTRLNK LLDEKWIAIL FNVLLIALFA       240
     LNLIKI                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page