(data stored in ACNUC10821 zone)

EMBL: AE017262.PE643

AE017262.PE643       Location/Qualifiers
FT   CDS             666993..667271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0627"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03433"
FT                   /protein_id="AAT03433.1"
FT                   /translation="MKRSWPDFAAFLLTILTVTWIILTWGLHISDIVPGGEKGVWYKLI
FT                   PLFLGIISTISVFFVKEKLVKWILLGFNILLLILIYFVYHIGEIGMF"
     MKRSWPDFAA FLLTILTVTW IILTWGLHIS DIVPGGEKGV WYKLIPLFLG IISTISVFFV        60
     KEKLVKWILL GFNILLLILI YFVYHIGEIG MF                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page