(data stored in ACNUC10821 zone)

EMBL: AE017262.PE645

AE017262.PE645       Location/Qualifiers
FT   CDS             complement(667594..668037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0653"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03435"
FT                   /protein_id="AAT03435.1"
FT                   /translation="MTASDLEDFLSTAITDYANEKVEAGTWDEEEALAKSQDSFNKLLY
FT                   DGITTPNEYLYSIISGEKIGYIWFHVDETRSGKHAFIYDFVIFEAFRGKGFGTKTLEAL
FT                   DALAKEMQITKIELHVFAHNQTAIGLYNKVGFQNTDITMAKYL"
     MTASDLEDFL STAITDYANE KVEAGTWDEE EALAKSQDSF NKLLYDGITT PNEYLYSIIS        60
     GEKIGYIWFH VDETRSGKHA FIYDFVIFEA FRGKGFGTKT LEALDALAKE MQITKIELHV       120
     FAHNQTAIGL YNKVGFQNTD ITMAKYL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page