(data stored in ACNUC10821 zone)

EMBL: AE017262.PE646

AE017262.PE646       Location/Qualifiers
FT   CDS             complement(668068..668769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0654"
FT                   /product="putative lipase/acylhydrolase"
FT                   /note="identified by match to protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03436"
FT                   /protein_id="AAT03436.1"
FT                   /translation="MKKTIQSVGVWGDSIMKGVLFNPEKNRYTLLKNNCIKRASEKLGL
FT                   TFQNHSTMGRTITKGHEILTKDLAKDATNDIAIIEFGGNDCDFNWTEVSENPTAEHIPS
FT                   TPLNIFETQLLEMIARLKKLDIKPILMTLPPLHAKRYFEFITRNGLNKDNILQFLGGDV
FT                   EMIYRWQERYSNTISRIAAETGSHIIDVRDSFLAEFHYENLLCADGIHPNEAGHIAMSR
FT                   KFIQYASFHKA"
     MKKTIQSVGV WGDSIMKGVL FNPEKNRYTL LKNNCIKRAS EKLGLTFQNH STMGRTITKG        60
     HEILTKDLAK DATNDIAIIE FGGNDCDFNW TEVSENPTAE HIPSTPLNIF ETQLLEMIAR       120
     LKKLDIKPIL MTLPPLHAKR YFEFITRNGL NKDNILQFLG GDVEMIYRWQ ERYSNTISRI       180
     AAETGSHIID VRDSFLAEFH YENLLCADGI HPNEAGHIAM SRKFIQYASF HKA              233
//

If you have problems or comments...

PBIL Back to PBIL home page