(data stored in ACNUC10821 zone)

EMBL: AE017262.PE647

AE017262.PE647       Location/Qualifiers
FT   CDS             complement(668854..670533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0655"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03437"
FT                   /protein_id="AAT03437.1"
FT                   /translation="MWKKHKWLIIAVLLLVIYVAPLFILGGNSHVRIHDNLDSNVTWYK
FT                   MVLDSGDYTAKVGTANIDQIMDDSVPRDSFDSEFVGIDWLYMIFSTPIAFAMSQLITRV
FT                   FAFLGLFLWARDYLIKDKKYLVPLYFVSLAFALTPFWPSGMLSTLGMPLALWAFLNIRN
FT                   NKRRIWNVVILTLLPFYSSLILGFCFFLVMVGCIWLYDVFKKKQVNIRFLLSMLYMTLL
FT                   YALVNYRFIYAMFLHPEPDSRSEFSLPELSFLSSIRLSFKNFIIGHTHDQALAGFVIIP
FT                   VLLLVLALIIIKREWGKEKLFLWLFGFNLFLSFWYGFWWYRGWNVIKEHVEIMRTFNFS
FT                   RFHFLQPFLFYGLFALAIVYLIKKGNWWRKLAYVVVALQLVVVFANNSEIYYRTGNGSP
FT                   SINQFYATEQMEEIKDYIGKPQSSYRVGSIGLHPSVSQESGFYTVDGYVNSYPLAYKRA
FT                   FRKIIAGELDKSPVLEDYYDNWGNRCYIFSAELGKNYDFGKDSKKHIKQLDFNSEAFKK
FT                   VGGKYILSAVPIDNASEVGLQFEKAFDNKESYWKIYLYKATK"
     MWKKHKWLII AVLLLVIYVA PLFILGGNSH VRIHDNLDSN VTWYKMVLDS GDYTAKVGTA        60
     NIDQIMDDSV PRDSFDSEFV GIDWLYMIFS TPIAFAMSQL ITRVFAFLGL FLWARDYLIK       120
     DKKYLVPLYF VSLAFALTPF WPSGMLSTLG MPLALWAFLN IRNNKRRIWN VVILTLLPFY       180
     SSLILGFCFF LVMVGCIWLY DVFKKKQVNI RFLLSMLYMT LLYALVNYRF IYAMFLHPEP       240
     DSRSEFSLPE LSFLSSIRLS FKNFIIGHTH DQALAGFVII PVLLLVLALI IIKREWGKEK       300
     LFLWLFGFNL FLSFWYGFWW YRGWNVIKEH VEIMRTFNFS RFHFLQPFLF YGLFALAIVY       360
     LIKKGNWWRK LAYVVVALQL VVVFANNSEI YYRTGNGSPS INQFYATEQM EEIKDYIGKP       420
     QSSYRVGSIG LHPSVSQESG FYTVDGYVNS YPLAYKRAFR KIIAGELDKS PVLEDYYDNW       480
     GNRCYIFSAE LGKNYDFGKD SKKHIKQLDF NSEAFKKVGG KYILSAVPID NASEVGLQFE       540
     KAFDNKESYW KIYLYKATK                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page