(data stored in ACNUC10821 zone)

EMBL: AE017262.PE65

AE017262.PE65        Location/Qualifiers
FT   CDS             66674..66967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0049; match
FT                   to protein family HMM PF06013"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02855"
FT                   /protein_id="AAT02855.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
     MSGQIRMSPS ELRDRAKTYG QSGRDIEDIL SRLSQLQEQL RSEWEGQAFM RFDDQFEQLK        60
     PKVTEFANLM DQINDQLEKT ANAVEEHDQQ LSQNFGF                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page