(data stored in ACNUC10821 zone)

EMBL: AE017262.PE652

AE017262.PE652       Location/Qualifiers
FT   CDS             678931..679383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0660"
FT                   /product="putative PTS system, fructose-specific, IIA
FT                   component"
FT                   /note="identified by similarity to SP:P32155; match to
FT                   protein family HMM PF00359; match to protein family HMM
FT                   TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03442"
FT                   /protein_id="AAT03442.1"
FT                   /translation="MGVKIDFLSISNINVNTKEEAILQLVNILGKADYLADKSLFEQAI
FT                   LERERTLSTYIGHEIGLPHAQSSGVKEPCVVVGKLSKPVKWTEEEEFVQIVFLIAVPRD
FT                   NQNNLHLKVLSNLARLLMHEDFRTKLSELDDTATVALLNKSVKEDN"
     MGVKIDFLSI SNINVNTKEE AILQLVNILG KADYLADKSL FEQAILERER TLSTYIGHEI        60
     GLPHAQSSGV KEPCVVVGKL SKPVKWTEEE EFVQIVFLIA VPRDNQNNLH LKVLSNLARL       120
     LMHEDFRTKL SELDDTATVA LLNKSVKEDN                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page