(data stored in ACNUC10821 zone)

EMBL: AE017262.PE653

AE017262.PE653       Location/Qualifiers
FT   CDS             679384..680445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0661"
FT                   /product="putative PTS system, fructose-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P32672; match to
FT                   protein family HMM PF02378; match to protein family HMM
FT                   TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03443"
FT                   /protein_id="AAT03443.1"
FT                   /translation="MRTLKFLQKHLMTATSYMIPFVVAGGILFALSVMLSGQAAVPDAG
FT                   WLAKLNQIGAAGLALFIPILGGYIAFSMADKPGLAPGMIGAYLANEIGAGFIGGIIAGF
FT                   LAGFVVIQLKKIKLAPSMRTLGSIFIYPLLGTLITGGIIVFLIGEPISGFMDWMTNALN
FT                   SLSGAAKVPLGALLGAMISFDMGGPVNKVAATFAQTQVDTLPYLMGGVGVAICVPPIGL
FT                   GVATLLFPKKFTRVEKDSGIAALLMGSVGITEGAIPFATADPLRVIPSIMVGSIVGNVS
FT                   AFLFGCLNHAPWGGLIVLPVVDNRIGYIASIALGAVVTAIMLRILKKDATELDEALEEG
FT                   QDIDDLDINFEDI"
     MRTLKFLQKH LMTATSYMIP FVVAGGILFA LSVMLSGQAA VPDAGWLAKL NQIGAAGLAL        60
     FIPILGGYIA FSMADKPGLA PGMIGAYLAN EIGAGFIGGI IAGFLAGFVV IQLKKIKLAP       120
     SMRTLGSIFI YPLLGTLITG GIIVFLIGEP ISGFMDWMTN ALNSLSGAAK VPLGALLGAM       180
     ISFDMGGPVN KVAATFAQTQ VDTLPYLMGG VGVAICVPPI GLGVATLLFP KKFTRVEKDS       240
     GIAALLMGSV GITEGAIPFA TADPLRVIPS IMVGSIVGNV SAFLFGCLNH APWGGLIVLP       300
     VVDNRIGYIA SIALGAVVTA IMLRILKKDA TELDEALEEG QDIDDLDINF EDI              353
//

If you have problems or comments...

PBIL Back to PBIL home page