(data stored in ACNUC10821 zone)

EMBL: AE017262.PE655

AE017262.PE655       Location/Qualifiers
FT   CDS             680795..682063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0663"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:15978906"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03445"
FT                   /protein_id="AAT03445.1"
FT                   /translation="MKLPIKKAVEALLKLQTTGDSATLIGVGPMSRNLLQASFELAKED
FT                   DYPLMFIASRNQVDADELGGGYVNGWNQFSFIEAIKEVAKEVDFDGLYYVCRDHGGPWQ
FT                   RDQERNDHLPTEKAMALGKKSYIADIEAGFDLLMIDPTKDPFEVGKVIPLETVLERTVD
FT                   LIAFCEEERKKRGLPEIGYEVGTEETNGGLTSTETYEKFITQLKVELEKRNLPLPTFIV
FT                   GQTGTLTRKTEQVGHFNFKNAYDLAQMAKKYGVGLKEHNGDYLDDVTLLEHIPSEITAT
FT                   NVAPQYGTEETRAYLKLVELEQKLVENGLIKTPSNAREVLLIQSIKSERWRKWMLDGQK
FT                   DITINEIMQDDDLSLEILDIAGHYTFNDAMVKKEIHTLYANLAANNIDGKRFVIDHIKR
FT                   PIRNYSECYNLKGATTRIKQLAK"
     MKLPIKKAVE ALLKLQTTGD SATLIGVGPM SRNLLQASFE LAKEDDYPLM FIASRNQVDA        60
     DELGGGYVNG WNQFSFIEAI KEVAKEVDFD GLYYVCRDHG GPWQRDQERN DHLPTEKAMA       120
     LGKKSYIADI EAGFDLLMID PTKDPFEVGK VIPLETVLER TVDLIAFCEE ERKKRGLPEI       180
     GYEVGTEETN GGLTSTETYE KFITQLKVEL EKRNLPLPTF IVGQTGTLTR KTEQVGHFNF       240
     KNAYDLAQMA KKYGVGLKEH NGDYLDDVTL LEHIPSEITA TNVAPQYGTE ETRAYLKLVE       300
     LEQKLVENGL IKTPSNAREV LLIQSIKSER WRKWMLDGQK DITINEIMQD DDLSLEILDI       360
     AGHYTFNDAM VKKEIHTLYA NLAANNIDGK RFVIDHIKRP IRNYSECYNL KGATTRIKQL       420
     AK                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page