(data stored in ACNUC10821 zone)

EMBL: AE017262.PE656

AE017262.PE656       Location/Qualifiers
FT   CDS             682153..682857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0664"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0664"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03446"
FT                   /protein_id="AAT03446.1"
FT                   /translation="MINLIFDIDDTVYDQLKPFENAFKTVFGKADHLKIENLYIKSRFY
FT                   SDEVYHRVVQGEMPKAKMHVYRITQALNDFDYQITKKEAEAFQHAYEQNQRKIELTSGI
FT                   KEILTWAKKNEITMGIITNGPKEHQQHKINDLQINDWIPTEHTFISGKVGIEKPDKKIF
FT                   KLVEEQIGIKGAETYYIGDSFENDVIGSKSAGWKSIWLNRRGHLIPTEAAFQPDYCVEN
FT                   EQQLFAILQEIF"
     MINLIFDIDD TVYDQLKPFE NAFKTVFGKA DHLKIENLYI KSRFYSDEVY HRVVQGEMPK        60
     AKMHVYRITQ ALNDFDYQIT KKEAEAFQHA YEQNQRKIEL TSGIKEILTW AKKNEITMGI       120
     ITNGPKEHQQ HKINDLQIND WIPTEHTFIS GKVGIEKPDK KIFKLVEEQI GIKGAETYYI       180
     GDSFENDVIG SKSAGWKSIW LNRRGHLIPT EAAFQPDYCV ENEQQLFAIL QEIF             234
//

If you have problems or comments...

PBIL Back to PBIL home page