(data stored in ACNUC10821 zone)

EMBL: AE017262.PE657

AE017262.PE657       Location/Qualifiers
FT   CDS             682962..683378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0665"
FT                   /product="Rrf2 family protein"
FT                   /note="identified by similarity to OMNI:NTL01BH0657; match
FT                   to protein family HMM PF02082; match to protein family HMM
FT                   TIGR00738"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0665"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03447"
FT                   /protein_id="AAT03447.1"
FT                   /translation="MKFSKATNYALHTMVYLANLSPEKSVGVKELATKQNVSPTYLSKV
FT                   LTMLVKAGFIESVTGVNGGYKLAEPASSISFLDVIQAIEGKGAFFHCDPKNHSESQPHC
FT                   LIGEVMNKAEQQMEDYLSKQTVGSIVVEIEKHQH"
     MKFSKATNYA LHTMVYLANL SPEKSVGVKE LATKQNVSPT YLSKVLTMLV KAGFIESVTG        60
     VNGGYKLAEP ASSISFLDVI QAIEGKGAFF HCDPKNHSES QPHCLIGEVM NKAEQQMEDY       120
     LSKQTVGSIV VEIEKHQH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page