(data stored in ACNUC10821 zone)

EMBL: AE017262.PE66

AE017262.PE66        Location/Qualifiers
FT   CDS             67116..70322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02856"
FT                   /protein_id="AAT02856.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQANAKMTSEFQILEDSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILRENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYSADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRSAFGEGFSFTTDPKTLPTDTLKSDTINRLKSEGVTLE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQTAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREASKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGAALLFTGL
FT                   NLFVWHRSKEEVEEDDSDEI"
     MKKVKWSILL FLVLAIFLSA GITYLALNQS SNKESKNNSE KTHKMTIALV NEDQGDNFQG        60
     KQVEFGNQFV KSIEKDDTHE WYVVSRGVAE SGLKRDVYNM MIVIPSDFSE KAMSMTSSAP       120
     EKVTISYKVN DVGNSDLKAE AEKTAASVLE DFNSRIIDVY FASILTTLQE AQDNIGTLVK       180
     EEKKYDAIYN KDVNNPLSSY TKQFKTVQDY TGTSKESFQG FQDIMKEFEE SLNLSQKENE       240
     EHMKNMDAYT KTQEENAPFG AEFTENLSKF DGTLSAEDIR MQTAALEQAN AKMTSEFQIL       300
     EDSNSLLSQT QALQSYIAET NARIDAVDAE IMGTLENDFR TAVYNDLLRI LRENEYSDKL       360
     NEIGLKDLTG EDINAGFNKM IVKEIQSLPT YSADQLASIG LDEEMYKNVV TLSKEYYSNH       420
     RSAFGEGFSF TTDPKTLPTD TLKSDTINRL KSEGVTLESS SYTVEGSDYP TEIILTLDEN       480
     FTFSDVDCLV NGSSNPELVQ QTAYGENGIK LSIQALGSTP AEIKITGKAK LREGVNVPLI       540
     GAVNWNATLQ QYEKKEYSEM PTIPSELDPT TPDTSLIVRK EPVPIKVTAP TYLNETKSSV       600
     KAITNTVKDY YKLQALFDLY YGIDASDSGQ IPDFSNYQVT LENSAKASSY YYIFNKEDVI       660
     GSFVNLTTDR FVADYTKKIK AFEKRIDDYK NTMAEANSRS EDVTNRLNET TQEAINLNTN       720
     LALTLQNLES WREASKGLIE ENGVVLEKSG EEATMALQLS SEFAGLLAES ESLAGTSEGN       780
     LKSAEVVYKT FDAIDKEAKN IQQSGETLVK EASTLSDDLS EKLEDDETFQ KNFAKVMENS       840
     RVGDRQNENL YSFLSSPVDK MNAGTIVAGD KSMPYFMILI CTILAIFTSY VISHQEKKRE       900
     QLNEFEKEMS LVFKNIPITF LAICVGIIEG LIIGAISGFI FEVGEIGMFL WIGVCVLIMM       960
     TLVTAFSYLL RQFNMIGMSI ILLVLSLYLF LTDAVGLNID NESIFATFRT FSPLQYMEYL      1020
     LNGILSAQKD YIIVVYSLIG AALLFTGLNL FVWHRSKEEV EEDDSDEI                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page